ABflo[R] 610 Rabbit anti-Human/Monkey CD20 monoclonal antibody
Product Sizes
100 tests
£384.00
A26466-100TESTS
200 tests
£610.00
A26466-200TESTS
500 tests
£1074.00
A26466-500TESTS
About this Product
- SKU:
- A26466
- Additional Names:
- B1|Bp35|CD20|CVID5|FMC7|LEU-16|S7
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo™ 610
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 14kDa/33kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Non-human Primate
- Sequence:
- LLAATEKNSRKCLVKGKMIMNSLSLFAAISGMILSIMDILNIKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQSLFLGILSVMLIF
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A26466
