PE Rabbit anti-Human CD88/C5aR monoclonal antibody
Product Sizes
10 tests
£ POA
A26387-10TESTS
100 tests
£288.00
A26387-100TESTS
200 tests
£449.00
A26387-200TESTS
500 tests
£782.00
A26387-500TESTS
About this Product
- SKU:
- A26387
- Additional Names:
- C5A|C5AR|C5R1|CD88
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Extra Details:
- Enables G protein-coupled receptor activity and complement component C5a receptor activity. Involved in several processes, including complement component C5a signaling pathway; mRNA transcription by RNA polymerase II; and positive regulation of ERK1 and ERK2 cascade. Located in apical part of cell and basolateral plasma membrane. Biomarker of Alzheimer's disease; asthma; chronic obstructive pulmonary disease; rhinitis; and severe acute respiratory syndrome.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 39kda
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDILALVIFAVVFLVGVLGNALVVWVTAFEAKRTINAIWFLNLAVADFLSCLALPILFTSIVQHH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A26387
