PE Rabbit anti-Human/Monkey CD69 monoclonal antibody
Product Sizes
10 tests
£ POA
A26384-10TESTS
100 tests
£164.00
A26384-100TESTS
200 tests
£241.00
A26384-200TESTS
500 tests
£390.00
A26384-500TESTS
About this Product
- SKU:
- A26384
- Additional Names:
- AIM|BL-AC/P26|CLEC2C|EA1|GP32/28|MLR-3
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Extra Details:
- This gene encodes a member of the calcium dependent lectin superfamily of type II transmembrane receptors. Expression of the encoded protein is induced upon activation of T lymphocytes, and may play a role in proliferation. Furthermore, the protein may act to transmit signals in natural killer cells and platelets.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 23kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Non-human Primate
- Sequence:
- SDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A26384
