ABflo[R] 488 Rabbit anti-Human TLR1 monoclonal antibody
Product Sizes
100 tests
£336.00
A26257-100TESTS
200 tests
£532.00
A26257-200TESTS
500 tests
£943.00
A26257-500TESTS
About this Product
- SKU:
- A26257
- Additional Names:
- CD281|rsc786|TIL|TIL. LPRS5
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 488
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 90kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- NMNIKNFTVSGTRMVHMLCPSKISPFLHLDFSNNLLTDTVFENCGHLTELETLILQMNQLKELSKIAEMTTQMKSLQQLDISQNSVSYDEKKGDCSWTKS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A26257
