ABflo[R] 700 Rabbit anti-Mouse CD11b monoclonal antibody
Product Sizes
10 tests
£ POA
A26230-10TESTS
100 tests
£152.00
A26230-100TESTS
200 tests
£217.00
A26230-200TESTS
500 tests
£354.00
A26230-500TESTS
About this Product
- SKU:
- A26230
- Additional Names:
- Cd11b|CD11b/CD18|CR3|CR3A|F730045J24Rik|Ly-40|Mac-1|Mac-1a|MAC1
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 700
- Extra Details:
- Enables complement component C3b binding activity; heparan sulfate proteoglycan binding activity; and heparin binding activity. Contributes to cargo receptor activity. Involved in several processes, including central nervous system development; endocytosis; and positive regulation of neuron death. Acts upstream of or within several processes, including activated T cell proliferation; leukocyte migration; and microglia development. Located in external side of plasma membrane and nucleus. Is integral component of membrane. Part of integrin alphaM-beta2 complex. Is expressed in several structures, including central nervous system; heart; lymphatic vessel; thymus; and yolk sac. Human ortholog(s) of this gene implicated in lupus nephritis. Orthologous to human ITGAM (integrin subunit alpha M).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- Refer to figures
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- ECPQQESDIVFLIDGSGSINNIDFQKMKEFVSTVMEQFKKSKTLFSLMQYSDEFRIHFTFNDFKRNPSPRSHVSPIKQLNGRTKTASGIRKVVRELFHKTNGARENAAKILVVITDGEKFGDPLDYKDVIPEADRAGVIRYVIGVGNAFNKPQSRRELDTIASKPAGEHVFQVDNFEALNTIQNQLQEKIFAIEG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A26230
