CD32 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A26173-5UL
20 ul
£164.00
A26173-20UL
100 ug
£342.00
A26173-100UG
500 ul
£1532.00
A26173-500UL
1000 ul
£2704.00
A26173-1000UL
About this Product
- SKU:
- A26173
- Additional Names:
- CD32|F630109E10Rik|Fc[g]RII|Fcgr2|Fcgr2a|FcgRII|Fcr-2|Fcr-3|fcRII|Ly-17|Ly-m20|LyM-1
- Application:
- ELISA, Flow Cytometry, IHC-Paraffin, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- CD32 (Fcgr2) is a 40 kD transmembrane glycoprotein, member of the immunoglobulin superfamily. The extracellular region of CD32 consists of two Ig C-type domains that binds the Fc region from monomeric IgG with low affinity, but binds immune complexes efficiently. CD32 can mediate phagocytosis of immune complexes and modulate cell activation. CD32 is expressed by Macrophages, neutrophils, mast cells and B cells.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 40-80 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- THDLPKAVVKLEPPWIQVLKEDTVTLTCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQLVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYSSNFSIPKANHSHSGDYYCKGSLGRTLHQSKPVTITVQGPKSSR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A26173
