FRA1 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A26169-5UL
20 ul
£164.00
A26169-20UL
100 ug
£342.00
A26169-100UG
500 ul
£1532.00
A26169-500UL
1000 ul
£2704.00
A26169-1000UL
About this Product
- SKU:
- A26169
- Additional Names:
- FRA|fra-1|FRA1
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. Several transcript variants encoding different isoforms have been found for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 40 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQI
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A26169
