Integrin alpha 3/CD49c Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A26152-5UL
20 ul
£164.00
A26152-20UL
100 ug
£342.00
A26152-100UG
500 ul
£1532.00
A26152-500UL
1000 ul
£2704.00
A26152-1000UL
About this Product
- SKU:
- A26152
- Additional Names:
- CD49C|FRP-2|GAP-B3|GAPB3|ILNEB|JEB7|MSK18|VCA-2|VL3A|VLA3a
- Application:
- ELISA, Flow Cytometry, IHC-Paraffin
- Clonality:
- Monoclonal
- Extra Details:
- The gene encodes a member of the integrin alpha chain family of proteins. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain that function as cell surface adhesion molecules. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha 3 subunit. This subunit joins with a beta 1 subunit to form an integrin that interacts with extracellular matrix proteins including members of the laminin family. Expression of this gene may be correlated with breast cancer metastasis.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- Refer to figures
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- INIVHKTLVPRPAVLDPALCTATSCVQVELCFAYNQSAGNPNYRRNITLAYTLEADRDRRPPRLRFAGSESAVFHGFFSMPEMRCQKLELLLMDNLRDKLRPIIISMNYSLPLRMPDRPRLGLRSLDAYPILNQAQALENHTEVQFQKECGPDNK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A26152
