ABflo[R] 450 Rabbit anti-Mouse CD107a/LAMP1 monoclonal antibody
Product Sizes
10 tests
£ POA
A26069-10TESTS
100 tests
£259.00
A26069-100TESTS
200 tests
£390.00
A26069-200TESTS
500 tests
£592.00
A26069-500TESTS
About this Product
- SKU:
- A26069
- Additional Names:
- CD107a|Lamp-1|LGP-120|LGP-A|P2B|Perk
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo™ 450
- Extra Details:
- Enables protein domain specific binding activity. Involved in protein stabilization. Located in several cellular components, including cytoplasmic vesicle; sarcolemma; and vacuole. Is expressed in several structures, including 1-cell stage embryo; central nervous system; craniocervical region bone; extraembryonic component; and gut. Orthologous to human LAMP1 (lysosomal associated membrane protein 1).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 43kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- PTVSKYNVTGNNGTCLLASMALQLNITYLKKDNKTVTRAFNISPNDTSSGSCGINLVTLKVENKNRALELQFGMNASSSLFFLQGVRLNMTLPDALVPTFSISNHSLKALQATVGNSYKCNTEEHIFVSKMLSLNVFSVQVQAFKVDSDRFGSVEE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A26069
