APC Rabbit anti-Mouse CD44 monoclonal antibody
Product Sizes
10 tests
£ POA
A26062-10TESTS
100 tests
£74.00
A26062-100TESTS
200 tests
£98.00
A26062-200TESTS
500 tests
£134.00
A26062-500TESTS
About this Product
- SKU:
- A26062
- Additional Names:
- HERMES|Ly-24|Pgp-1
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- APC
- Extra Details:
- Enables hyaluronic acid binding activity and type II transforming growth factor beta receptor binding activity. Contributes to cytokine binding activity and cytokine receptor activity. Involved in several processes, including negative regulation of T cell activation; positive regulation of protein phosphorylation; and regulation of intracellular signal transduction. Acts upstream of or within several processes, including Wnt signaling pathway; morphogenesis of a branching epithelium; and wound healing involved in inflammatory response. Located in basolateral plasma membrane; external side of plasma membrane; and microvillus. Part of macrophage migration inhibitory factor receptor complex. Is expressed in several structures, including alimentary system; branchial arch; central nervous system; genitourinary system; and limb. Human ortholog(s) of this gene implicated in breast carcinoma (multiple); carcinoma (multiple); and prostate cancer. Orthologous to human CD44 (CD44 molecule (Indian blood group)).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- Refer to figures
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- QIDLNVTCRYAGVFHVEKNGRYSISRTEAADLCQAFNSTLPTMDQMKLALSKGFETCRYGFIEGNVVIPRIHPNAICAANHTGVYILVTSNTSHYDTYCFNASAPPEEDCTSVTDLPNSFDGPVTITIVNRDGTRYSKKGEYRTHQEDIDASNI
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A26062
