PE Rabbit anti-Mouse CD196/CCR6 monoclonal antibody
Product Sizes
10 tests
£ POA
A26056-10TESTS
100 tests
£92.00
A26056-100TESTS
200 tests
£122.00
A26056-200TESTS
500 tests
£134.00
A26056-500TESTS
About this Product
- SKU:
- A26056
- Additional Names:
- CC-CKR-6|CCR-6|Cmkbr6|KY411
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Extra Details:
- Enables C-C chemokine binding activity and C-C chemokine receptor activity. Involved in several processes, including immune system development; leukocyte migration; and regulation of cell motility. Located in external side of plasma membrane; sperm plasma membrane; and sperm principal piece. Is expressed in several structures, including central nervous system; gut; immune system; male reproductive gland or organ; and retina. Orthologous to human CCR6 (C-C motif chemokine receptor 6).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- Refer to figures
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- NSTESYFGTDDYDNTEYYSIPPDHGPCSLEEVRNFTK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A26056
