CCL17 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A25954-5UL
20 ul
£164.00
A25954-20UL
100 ug
£342.00
A25954-100UG
500 ul
£1532.00
A25954-500UL
1000 ul
£2704.00
A25954-1000UL
About this Product
- SKU:
- A25954
- Additional Names:
- A-152E5.3|ABCD-2|SCYA17|TARC
- Application:
- ELISA, IHC-Paraffin, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- This antimicrobial gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for T lymphocytes, but not monocytes or granulocytes. The product of this gene binds to chemokine receptors CCR4 and CCR8. This chemokine plays important roles in T cell development in thymus as well as in trafficking and activation of mature T cells.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 10kDa (Full-length protein) /38-40kDa (Recombinant Protein)
- Purification:
- Affinity Purified
- Reactivities:
- Human, Rat
- Sequence:
- ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A25954
