GM-CSF Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A25953-5UL
20 ul
£164.00
A25953-20UL
100 ug
£342.00
A25953-100UG
500 ul
£1532.00
A25953-500UL
1000 ul
£2704.00
A25953-1000UL
About this Product
- SKU:
- A25953
- Additional Names:
- CSF|Csfgm|Gm-CSf|GMCSF|MGI-IGM
- Application:
- ELISA, Immunocytochemistry, Immunofluorescence, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- Enables cytokine activity. Acts upstream of or within several processes, including embryonic placenta development; myeloid leukocyte differentiation; and positive regulation of cell population proliferation. Located in extracellular space. Is expressed in several structures, including genitourinary system; hemolymphoid system; labyrinthine zone; liver; and lung. Used to study pulmonary alveolar proteinosis. Human ortholog(s) of this gene implicated in acute myeloid leukemia; juvenile myelomonocytic leukemia; neutropenia; pulmonary alveolar proteinosis; and visceral leishmaniasis. Orthologous to human CSF2 (colony stimulating factor 2).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 20-35kDa (Recombinant Protein)
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A25953
