Fibronectin Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A25907-20UL
100 ug
£336.00
A25907-100UG
500 ul
£1258.00
A25907-500UL
1000 ul
£2228.00
A25907-1000UL
About this Product
- SKU:
- A25907
- Additional Names:
- E330027I09|Fn|Fn-1
- Application:
- ELISA, Immunocytochemistry, Immunofluorescence, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Enables peptidase activator activity. Acts upstream of or within several processes, including calcium-independent cell-matrix adhesion; cell-substrate junction assembly; and positive regulation of axon extension. Located in apical plasma membrane and basement membrane. Is expressed in several structures, including alimentary system; cardiovascular system; egg cylinder; embryo mesenchyme; and genitourinary system. Human ortholog(s) of this gene implicated in calcium oxalate nephrolithiasis; membranoproliferative glomerulonephritis; and spondylometaphyseal dysplasia corner fracture type. Orthologous to human FN1 (fibronectin 1).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 272 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- ALSQTTISWTPFQESSEYIISCQPVGTDEEPLQFQVPGTSTSATLTGLTRGVTYNIIVEALQNQRRHKVREEVVTVGNAVSEGLNQPTDDSCFDPYTVSHYAIGEEWERLSDAGFKLTCQCLGFGSGHFRCDSSKWCHDNGVNYKIGEKWDRQGENGQRMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGAAEPSPDGTTGHTYNQYTQRYNQRTNTNVNCPIECFMPLDVQADRDDSRE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A25907
