Nanog Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A25887-5UL
20 ul
£164.00
A25887-20UL
100 ug
£342.00
A25887-100UG
500 ul
£1455.00
A25887-500UL
1000 ul
£2704.00
A25887-1000UL
About this Product
- SKU:
- A25887
- Additional Names:
- 2410002E02Rik|ecat4|ENK|Stm1
- Application:
- ChIP, ELISA, Flow Cytometry, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- The protein encoded by this gene is a DNA binding homeobox transcription factor involved in embryonic stem (ES) cell proliferation, renewal, and pluripotency. The encoded protein can block ES cell differentiation and can also autorepress its own expression in differentiating cells. Several transcript variants encoding different isoforms have been found for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 35-42kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Sequence:
- LKTSNGLIQKGSAPVEYPSIHCSYPQGYLVNASGSLSMWGSQTWTNPTWSSQTWTNPTWNNQTWTNPTWSSQAWTAQSWNGQPWNAAPLHNFGEDFLQPYVQLQQNFSASDLEVNLEATRESHAHFSTPQALELFLNYSVTPPGEI
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A25887
