Dopamine Transporter/DAT Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A25875-5UL
20 ul
£164.00
A25875-20UL
100 ug
£342.00
A25875-100UG
500 ul
£1532.00
A25875-500UL
1000 ul
£2704.00
A25875-1000UL
About this Product
- SKU:
- A25875
- Additional Names:
- DAT|DAT1|PKDYS|PKDYS1
- Application:
- Detection/Quantitation, ELISA, IHC-Paraffin, Immunofluorescence, Immunohistochemistry, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- This gene encodes a dopamine transporter which is a member of the sodium- and chloride-dependent neurotransmitter transporter family. The 3' UTR of this gene contains a 40 bp tandem repeat, referred to as a variable number tandem repeat or VNTR, which can be present in 3 to 11 copies. Variation in the number of repeats is associated with idiopathic epilepsy, attention-deficit hyperactivity disorder, dependence on alcohol and cocaine, susceptibility to Parkinson disease and protection against nicotine dependence.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 70-85 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse, Rat
- Sequence:
- MSKSKCSVGLMSSVVAPAKEPNAVGPKEVELILVKEQNGVQLTSSTLTNPRQSPVEAQDRETWGKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLV
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A25875
