[KD Validated] POLR2L Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A25872-5UL
20 ul
£164.00
A25872-20UL
100 ug
£342.00
A25872-100UG
500 ul
£1532.00
A25872-500UL
1000 ul
£2704.00
A25872-1000UL
About this Product
- SKU:
- A25872
- Additional Names:
- hRPB7.6|RBP10|RPABC5|RPB10|RPB10beta|RPB7.6
- Application:
- ELISA, IHC-Paraffin, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- This gene encodes a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene contains four conserved cysteines characteristic of an atypical zinc-binding domain. Like its counterpart in yeast, this subunit may be shared by the other two DNA-directed RNA polymerases.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence within amino acids 1-67 of human POLR2L (NP_066951.1).
- Isotype:
- IgG
- Molecular Weight:
- 8kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A25872
