ABflo[R] 594 Rabbit anti-Mouse CD226/DNAM-1 monoclonal antibody
Product Sizes
10 tests
£ POA
A25864-10TESTS
100 tests
£146.00
A25864-100TESTS
200 tests
£211.00
A25864-200TESTS
500 tests
£342.00
A25864-500TESTS
About this Product
- SKU:
- A25864
- Additional Names:
- DNAM-1|DNAM1|Pta1|TLiSA1
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 647
- Extra Details:
- Predicted to enable integrin binding activity and protein kinase binding activity. Acts upstream of or within positive regulation of interferon-gamma production and positive regulation of natural killer cell cytokine production. Located in external side of plasma membrane. Is expressed in embryo. Orthologous to human CD226 (CD226 molecule).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 38kda
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- EETLWDTTVRLSETMTLECVYPLTHNLTQVEWTKNTGTKTVSIAVYNPNHNMHIESNYLHRVHFLNSTVGFRNMSLSFYNASEADIGIYSCLFHAFPNGPWEKKIKVVWSDSFEIAAPSDSYLSAEPGQDVTLTCQLPRTWPVQQVIWEKVQPHQVDILASCNLSQETRYTSKYLRQTRSNCSQGSMKSILIIPNAMAADSGLYRCRSEAITGKNKSFVIRLIITDGGTNKHFILP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A25864
