CCL4 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A25848-20UL
100 ug
£336.00
A25848-100UG
500 ul
£1258.00
A25848-500UL
1000 ul
£2228.00
A25848-1000UL
About this Product
- SKU:
- A25848
- Additional Names:
- Act-2|AT744.1|MIP-1B|Mip1b|Scya4
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Predicted to enable chemokine receptor binding activity and identical protein binding activity. Acts upstream of or within cellular response to xenobiotic stimulus. Located in extracellular space. Is expressed in central nervous system; genitourinary system; and retina. Human ortholog(s) of this gene implicated in acquired immunodeficiency syndrome and human immunodeficiency virus infectious disease. Orthologous to several human genes including CCL4L2 (C-C motif chemokine ligand 4 like 2).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 12kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A25848
