ABflo[R] 488 Rabbit anti-Mouse CD11a monoclonal antibody
Product Sizes
10 tests
£ POA
A25827-10TESTS
100 tests
£128.00
A25827-100TESTS
200 tests
£181.00
A25827-200TESTS
500 tests
£294.00
A25827-500TESTS
About this Product
- SKU:
- A25827
- Additional Names:
- (p180)|Cd11a|LFA-1|LFA-1A|Ly-15|Ly-21
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 488
- Extra Details:
- Predicted to enable ICAM-3 receptor activity and cell adhesion molecule binding activity. Involved in cell-cell adhesion. Acts upstream of or within several processes, including activated T cell proliferation; positive regulation of T cell proliferation; and positive regulation of calcium-mediated signaling. Located in cell-cell junction; external side of plasma membrane; and immunological synapse. Is expressed in heart; hemolymphoid system; and vault of skull. Orthologous to human ITGAL (integrin subunit alpha L).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 128kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- KGKVDLVFLFDGSQSLDRKDFEKILEFMKDVMRKLSNTSYQFAAVQFSTDCRTEFTFLDYVKQNKNPDVLLGSVQPMFLLTNTFRAINYVVAHVFKEESGARPDATKVLVIITDGEASDKGNISAAHDITRYIIGIGKHFVSVQKQKTLHIFASEPVEEFVKILDTFEKLKDLFTDLQRRIYAIEGTNRQDL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A25827
