ABCG2 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A25820-5UL
20 ul
£164.00
A25820-20UL
100 ug
£342.00
A25820-100UG
500 ul
£1532.00
A25820-500UL
1000 ul
£2704.00
A25820-1000UL
About this Product
- SKU:
- A25820
- Additional Names:
- ABC15|ABCP|BCRP|BCRP1|BMDP|CD338|CDw338|CDw388|EST157481|GOUT1|MRX|MXR|MXR-1|MXR1|UAQTL1
- Application:
- ELISA, Immunofluorescence, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- The membrane-associated protein encoded by this gene is included in the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. Alternatively referred to as a breast cancer resistance protein, this protein functions as a xenobiotic transporter which may play a major role in multi-drug resistance. It likely serves as a cellular defense mechanism in response to mitoxantrone and anthracycline exposure. Significant expression of this protein has been observed in the placenta, which may suggest a potential role for this molecule in placenta tissue. Multiple transcript variants encoding different isoforms have been found for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 65-70kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Sequence:
- GLSGDVLINGAPRPANFKCNSGYVVQDDVVMGTLTVRENLQFSAALRLATTMTNHEKNERINRVIQELGLDKVADSKVGTQFIRGVSGGERKRTSIGMEL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A25820
