IFN-beta Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A25818-5UL
20 ul
£164.00
A25818-20UL
100 ug
£342.00
A25818-100UG
500 ul
£1532.00
A25818-500UL
1000 ul
£2704.00
A25818-1000UL
About this Product
- SKU:
- A25818
- Additional Names:
- If1da1|Ifb|IFN-beta|IFNB
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- Enables cytokine activity and type I interferon receptor binding activity. Involved in B cell proliferation; cellular response to virus; and type I interferon signaling pathway. Acts upstream of or within several processes, including cellular response to organic cyclic compound; defense response to other organism; and negative regulation of osteoclast differentiation. Located in extracellular space. Is expressed in embryo and liver. Human ortholog(s) of this gene implicated in COVID-19. Orthologous to human IFNB1 (interferon beta 1).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 24kDa/26kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- MNNRWILHAAFLLCFSTTALSINYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A25818
