Arginase-1 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A25808-5UL
20 ul
£164.00
A25808-20UL
100 ug
£342.00
A25808-100UG
500 ul
£1532.00
A25808-500UL
1000 ul
£2704.00
A25808-1000UL
About this Product
- SKU:
- A25808
- Additional Names:
- AI|Arg-1|Arginase-1|PGIF
- Application:
- ELISA, IHC-Paraffin, Immunofluorescence, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- Enables arginase activity. Involved in defense response to protozoan; negative regulation of T-helper 2 cell cytokine production; and negative regulation of activated T cell proliferation. Predicted to be located in several cellular components, including extracellular space; mitochondrial outer membrane; and neuronal cell body. Predicted to be active in cytosol. Is expressed in several structures, including alimentary system; central nervous system; genitourinary system; integumental system; and sensory organ. Used to study hyperargininemia. Human ortholog(s) of this gene implicated in asthma; hepatocellular carcinoma; and hyperargininemia. Orthologous to human ARG1 (arginase 1).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 40kda
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- MSSKPKSLEIIGAPFSKGQPRGGVEKGPAALRKAGLLEKLKETEYDVRDHGDLAFVDVPNDSSFQIVKNPRSVGKANEELAGVVAEVQKNGRVSVVLGGD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A25808
