Lif Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A25755-20UL
100 ug
£336.00
A25755-100UG
500 ul
£1258.00
A25755-500UL
1000 ul
£2228.00
A25755-1000UL
About this Product
- SKU:
- A25755
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Enables cytokine activity and growth factor activity. Acts upstream of or within several processes, including animal organ development; generation of neurons; and positive regulation of macromolecule metabolic process. Located in extracellular space. Is expressed in several structures, including alimentary system; central nervous system; cranium; early conceptus; and female reproductive system. Orthologous to human LIF (LIF interleukin 6 family cytokine).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 26kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A25755
