ABflo[R] 647 Rabbit anti-Mouse CD252/OX40L monoclonal antibody
Product Sizes
10 tests
£ POA
A25746-10TESTS
100 tests
£229.00
A25746-100TESTS
200 tests
£360.00
A25746-200TESTS
500 tests
£622.00
A25746-500TESTS
About this Product
- SKU:
- A25746
- Additional Names:
- Ath-1|Ath1|CD134L|gp34|OX-40L|Ox40l|Tnlg2b|TXGP1|Txgp1l
- Application:
- Flow Cytometry, Immunocytochemistry, Immunofluorescence
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 647
- Extra Details:
- Enables tumor necrosis factor receptor binding activity. Involved in several processes, including T cell activation; regulation of gene expression; and regulation of lymphocyte activation. Acts upstream of or within cholesterol metabolic process; inflammatory response; and negative regulation of cytokine production. Predicted to be located in cell surface. Predicted to be active in extracellular space. Is expressed in sensory organ and skeleton. Used to study primary pulmonary hypertension and type 1 diabetes mellitus. Human ortholog(s) of this gene implicated in myocardial infarction. Orthologous to human TNFSF4 (TNF superfamily member 4).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 22kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- SSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A25746
