ABflo[R] 488 Rabbit anti-Mouse CD252/OX40L monoclonal antibody
Product Sizes
100 tests
£98.00
A25745-100TESTS
200 tests
£134.00
A25745-200TESTS
500 tests
£199.00
A25745-500TESTS
About this Product
- SKU:
- A25745
- Additional Names:
- Ath-1|Ath1|CD134L|gp34|OX-40L|Ox40l|Tnlg2b|TXGP1|Txgp1l
- Application:
- Flow Cytometry, Immunocytochemistry, Immunofluorescence
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 488
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 22kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- SSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A25745
