PE Rabbit anti-Mouse CD366/TIM-3/HAVCR2 monoclonal antibody
Product Sizes
10 tests
£ POA
A25729-10TESTS
100 tests
£259.00
A25729-100TESTS
200 tests
£390.00
A25729-200TESTS
500 tests
£592.00
A25729-500TESTS
About this Product
- SKU:
- A25729
- Additional Names:
- TIM-3|Tim3|Timd3
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Extra Details:
- Predicted to enable metal ion binding activity. Involved in several processes, including regulation of cytokine production; regulation of leukocyte activation; and toll-like receptor signaling pathway. Located in cell surface; early endosome; and immunological synapse. Is expressed in several structures, including dorsal aorta; gut; liver; lung; and reproductive system. Human ortholog(s) of this gene implicated in hepatocellular carcinoma and renal cell carcinoma. Orthologous to human HAVCR2 (hepatitis A virus cellular receptor 2).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- Refer to figures
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- RSLENAYVFEVGKNAYLPCSYTLSTPGALVPMCWGKGFCPWSQCTNELLRTDERNVTYQKSSRYQLKGDLNKGDVSLIIKNVTLDDHGTYCCRIQFPGLMNDKKLELKLDIKAAKVTPAQTAHGDSTTASPRTLTTERNGSETQTLVTLHNNNGTKISTWADEIKDSGETIR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A25729
