Biotin Rabbit anti-Human CD40 monoclonal antibody
Product Sizes
500 tests
£152.00
A25703-500TESTS
About this Product
- SKU:
- A25703
- Additional Names:
- Bp50|CDW40|p50|TNFRSF5
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- Biotin
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 22kDa/31kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A25703
