PE Rabbit anti-Mouse/Rat CD27 monoclonal antibody
Product Sizes
10 tests
£ POA
A25696-10TESTS
100 tests
£116.00
A25696-100TESTS
200 tests
£158.00
A25696-200TESTS
500 tests
£217.00
A25696-500TESTS
About this Product
- SKU:
- A25696
- Additional Names:
- S152|Tnfrsf7|Tp55
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Extra Details:
- Predicted to enable cysteine-type endopeptidase inhibitor activity involved in apoptotic process. Involved in negative regulation of apoptotic process and positive regulation of JNK cascade. Acts upstream of or within negative regulation of T cell apoptotic process. Located in external side of plasma membrane. Is expressed in several structures, including femur; hemolymphoid system; intestine; pituitary gland; and reproductive system. Human ortholog(s) of this gene implicated in lymphoproliferative syndrome 2. Orthologous to human CD27 (CD27 molecule).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 28kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse, Rat
- Sequence:
- PNSCPDKHYWTGGGLCCRMCEPGTFFVKDCEQDRTAAQCDPCIPGTSFSPDYHTRPHCESCRHCNSGFLIRNCTVTANAECSCSKNWQCRDQECTECDPPLNPALTRQPSETPSPQPPPTHLPHGTEKPSWPLHRQLPNSTVYSQRSSHRPLCSSDCIR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A25696
