FSH alpha/beta Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A25649-5UL
20 ul
£164.00
A25649-20UL
100 ug
£342.00
A25649-100UG
500 ul
£1532.00
A25649-500UL
1000 ul
£2704.00
A25649-1000UL
About this Product
- SKU:
- A25649
- Additional Names:
- CG-ALPHA|FSHA|FSHB|GPA1|GPHa|GPHA1|HCG|LHA|TSHA
- Application:
- ELISA, IHC-Paraffin, Immunofluorescence
- Clonality:
- Monoclonal
- Extra Details:
- The four human glycoprotein hormones chorionic gonadotropin (CG), luteinizing hormone (LH), follicle stimulating hormone (FSH), and thyroid stimulating hormone (TSH) are dimers consisting of alpha and beta subunits that are associated noncovalently. The alpha subunits of these hormones are identical, however, their beta chains are unique and confer biological specificity. The protein encoded by this gene is the alpha subunit and belongs to the glycoprotein hormones alpha chain family. Two transcript variants encoding different isoforms have been found for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 25-116 of human FSH alpha/beta(NP_000726.1/NP_000501.1).
- Isotype:
- IgG
- Molecular Weight:
- 13kDa/15kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A25649
