RXRB Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A25648-5UL
20 ul
£164.00
A25648-20UL
100 ug
£342.00
A25648-100UG
500 ul
£1532.00
A25648-500UL
1000 ul
£2704.00
A25648-1000UL
About this Product
- SKU:
- A25648
- Additional Names:
- DAUDI6|H-2RIIBP|NR2B2|RCoR-1|RXR-beta|RXRbeta
- Application:
- ChIP, ELISA, Immunoprecipitation, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- This gene encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the effects of retinoic acid (RA). The encoded protein forms homodimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. This gene lies within the major histocompatibility complex (MHC) class II region on chromosome 6. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 72 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- MSWAARPPFLPQRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAAAAAAAVAGGEQQTPEPEPGEAGRDGMGDSGRDSRSPDSSSPNPLPQGVPPPSP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A25648
