[KO Validated] MLH1 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A25641-5UL
20 ul
£164.00
A25641-20UL
100 ug
£342.00
A25641-100UG
500 ul
£1532.00
A25641-500UL
1000 ul
£2704.00
A25641-1000UL
About this Product
- SKU:
- A25641
- Additional Names:
- COCA2|FCC2|hMLH1|HNPCC|HNPCC2|LYNCH2|MLH-1|MMRCS1
- Application:
- Detection/Quantitation, ELISA, IHC-Paraffin, Immunohistochemistry, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- The protein encoded by this gene can heterodimerize with mismatch repair endonuclease PMS2 to form MutL alpha, part of the DNA mismatch repair system. When MutL alpha is bound by MutS beta and some accessory proteins, the PMS2 subunit of MutL alpha introduces a single-strand break near DNA mismatches, providing an entry point for exonuclease degradation. The encoded protein is also involved in DNA damage signaling and can heterodimerize with DNA mismatch repair protein MLH3 to form MutL gamma, which is involved in meiosis. This gene was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 85 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Sequence:
- PGLAGPSGEMVKSTTSLTSSSTSGSSDKVYAHQMVRTDSREQKLDAFLQPLSKPLSSQPQAIVTEDKTDISSGRARQQDEEMLELPAPAEVAAKNQSLEGD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A25641
