[KD Validated] eIF4E Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A25608-5UL
20 ul
£164.00
A25608-20UL
100 ug
£342.00
A25608-100UG
500 ul
£1532.00
A25608-500UL
1000 ul
£2704.00
A25608-1000UL
About this Product
- SKU:
- A25608
- Additional Names:
- AUTS19|CBP|eIF-4E|EIF4E1|EIF4EL1|EIF4F
- Application:
- ELISA, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- The protein encoded by this gene is a component of the eukaryotic translation initiation factor 4F complex, which recognizes the 7-methylguanosine cap structure at the 5' end of messenger RNAs. The encoded protein aids in translation initiation by recruiting ribosomes to the 5'-cap structure. Association of this protein with the 4F complex is the rate-limiting step in translation initiation. This gene acts as a proto-oncogene, and its expression and activation is associated with transformation and tumorigenesis. Several pseudogenes of this gene are found on other chromosomes. Alternative splicing results in multiple transcript variants.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 25kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Non-human Primate, Rat
- Sequence:
- MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A25608
