YBEY Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A25601-20UL
100 ug
£336.00
A25601-100UG
500 ul
£1258.00
A25601-500UL
1000 ul
£2228.00
A25601-1000UL
About this Product
- SKU:
- A25601
- Additional Names:
- C21orf57
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This gene encodes a highly conserved metalloprotein. A similar protein in bacteria acts as an endoribonuclease, and is thought to function in ribosomal RNA maturation and ribosome assembly. Alternative splicing results in multiple transcript variants.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 19kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Rat
- Sequence:
- FHEHLKAGEFPQPDFPDDYNLGDIFLGVEYIFHQCKENEDYNDVLTVTATHGLCHLLGFTHGTEAEWQQMFQKEKAVLDELGRRTGTRLQPLTRGLFGGS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A25601
