IL-15RA Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A25576-5UL
20 ul
£164.00
A25576-20UL
100 ug
£342.00
A25576-100UG
500 ul
£1532.00
A25576-500UL
1000 ul
£2704.00
A25576-1000UL
About this Product
- SKU:
- A25576
- Additional Names:
- Il15ra
- Application:
- ELISA, Flow Cytometry, Immunocytochemistry, Immunofluorescence
- Clonality:
- Monoclonal
- Extra Details:
- Predicted to enable interleukin-15 receptor activity and protein kinase binding activity. Acts upstream of or within positive regulation of natural killer cell differentiation. Located in cytoplasmic vesicle and plasma membrane. Is expressed in central nervous system; retina; retina inner nuclear layer; and retina outer nuclear layer. Orthologous to human IL15RA (interleukin 15 receptor subunit alpha).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- Refer to figures
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- GTTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDPSLAHYSPVPTVVTPKVTSQPESPSPSAKEPEAFSPKSDTAMTTETAIMPGSRLTPSQTTSAGTTGTGSHKSSRAPSLAATMTLEPTASTSLRITEISPHSSKMTK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A25576
