ABflo[R] 488 Rabbit anti-Mouse CD215/IL-15RA Alpha monoclonal antibody
Product Sizes
10 tests
£ POA
A25573-10TESTS
100 tests
£175.00
A25573-100TESTS
200 tests
£265.00
A25573-200TESTS
500 tests
£449.00
A25573-500TESTS
About this Product
- SKU:
- A25573
- Additional Names:
- Il15ra
- Application:
- Flow Cytometry, Immunocytochemistry, Immunofluorescence
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 488
- Extra Details:
- Predicted to enable interleukin-15 receptor activity and protein kinase binding activity. Acts upstream of or within positive regulation of natural killer cell differentiation. Located in cytoplasmic vesicle and plasma membrane. Is expressed in central nervous system; retina; retina inner nuclear layer; and retina outer nuclear layer. Orthologous to human IL15RA (interleukin 15 receptor subunit alpha).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- Refer to figures
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- GTTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDPSLAHYSPVPTVVTPKVTSQPESPSPSAKEPEAFSPKSDTAMTTETAIMPGSRLTPSQTTSAGTTGTGSHKSSRAPSLAATMTLEPTASTSLRITEISPHSSKMTK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A25573
