ABflo[R] 488 Rabbit anti-Mouse CD205/DEC-205 monoclonal antibody
Product Sizes
10 tests
£ POA
A25530-10TESTS
100 tests
£164.00
A25530-100TESTS
200 tests
£241.00
A25530-200TESTS
500 tests
£342.00
A25530-500TESTS
About this Product
- SKU:
- A25530
- Additional Names:
- CD205|DEC-205|DEC205
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 488
- Extra Details:
- Predicted to enable signaling receptor activity. Predicted to act upstream of or within endocytosis. Located in external side of plasma membrane. Is expressed in thymus and thymus primordium. Orthologous to several human genes including LY75-CD302 (LY75-CD302 readthrough).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- Refer to figures
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- CEGNWEKNEQIGSCYQFNNQEILSWKEAYVSCQNQGADLLSIHSAAELAYITGKEDIARLVWLGLNQLYSARGWEWSDFRPLKFLNWDPGTPVAPVIGGSSCARMDTESGLWQSVSCESQQPYVCKKPLNNTLELPDVWTYTDTHCHVGWLPNNGFCYLLANESSSWDAAHLKCKAFGADLISMHSLADVEVVVTKLHNGDVKKEIWTGLKNTNSPALFQWSDGTEVTLTYWNENEPSVPFNKTPNCVSYLGKLGQWKVQSCEKKLRYVCKKKGE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A25530
