ABflo[R] 488 Rabbit anti-Mouse CD72 monoclonal antibody
Product Sizes
10 tests
£ POA
A25518-10TESTS
100 tests
£259.00
A25518-100TESTS
200 tests
£390.00
A25518-200TESTS
500 tests
£592.00
A25518-500TESTS
About this Product
- SKU:
- A25518
- Additional Names:
- CD72c|Ly-19|Ly-32|Ly-m19|Lyb-2
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 488
- Extra Details:
- Predicted to enable carbohydrate binding activity and transmembrane signaling receptor activity. Predicted to be located in membrane. Predicted to be integral component of membrane. Predicted to be integral component of plasma membrane. Is expressed in brain; cerebellum external granule cell layer; cerebellum internal granule cell layer; hippocampus; and neocortex. Orthologous to human CD72 (CD72 molecule).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- Refer to figures
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- DSSDTCCPCGWIPYQERCFYISHTLGSLEESQKYCTSLSSKLAAFDEPSKYYYEVSLPSGLEELLDRSKSYWIQMSKKWRQDSDSQSRHCVRIKTYYQKWERTISKCAELHPCICESEAFRFPDGINLN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A25518
