PE Rabbit anti-Human CD270/HVEM monoclonal antibody
Product Sizes
10 tests
£ POA
A25414-10TESTS
100 tests
£288.00
A25414-100TESTS
200 tests
£449.00
A25414-200TESTS
500 tests
£687.00
A25414-500TESTS
About this Product
- SKU:
- A25414
- Additional Names:
- ATAR|CD270|HVEA|HVEM|LIGHTR|TNF receptor superfamily member 14|TNFRSF14|TR2
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Extra Details:
- This gene encodes a member of the TNF (tumor necrosis factor) receptor superfamily. The encoded protein functions in signal transduction pathways that activate inflammatory and inhibitory T-cell immune response. It binds herpes simplex virus (HSV) viral envelope glycoprotein D (gD), mediating its entry into cells. Alternative splicing results in multiple transcript variants.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- Refer to figures
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- LPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLC
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A25414
