ABflo[R] 488 Rabbit anti-Mouse CD126/IL-6RA Alpha chain monoclonal antibody
Product Sizes
10 tests
£ POA
A25149-10TESTS
100 tests
£324.00
A25149-100TESTS
200 tests
£509.00
A25149-200TESTS
500 tests
£782.00
A25149-500TESTS
About this Product
- SKU:
- A25149
- Additional Names:
- CD126|IL-6R|IL-6R-alpha|IL-6RA|Il6r
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 488
- Extra Details:
- Enables interleukin-6 binding activity and interleukin-6 receptor activity. Involved in T-helper 17 cell lineage commitment and interleukin-6-mediated signaling pathway. Located in cell surface. Part of interleukin-6 receptor complex. Is expressed in several structures, including adipose tissue; alimentary system; genitourinary system; hemolymphoid system; and nervous system. Human ortholog(s) of this gene implicated in Alzheimer's disease; Huntington's disease; hyper IgE syndrome; obesity; and stomach cancer. Orthologous to human IL6R (interleukin 6 receptor).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 50kda
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- LVLGSCRALEVANGTVTSLPGATVTLICPGKEAAGNVTIHWVYSGSQNREWTTTGNTLVLRDVQLSDTGDYLCSLNDHLVGTVPLLVDVPPEEPKLSCFRKNPLVNAICEWRPSSTPSPTTKAVLFAKKINTTNGKSDFQVPCQYSQQLKSFSCQVEILEGDKVYHIVSLCVANSVGSKSSHNEAFHSLKMVQPDPPANLVVSAIPGRPRWLKVSWQHPETWDPSYYLLQFQLRYRPVWSKEFTVLLLPVAQYQCVIHDALRGVKHVVQVRGKEELDLGQWSEWSPEVTGTPWIAEPRTTPAGILWNPTQVSVEDSANHEDQYESSTEATSVLAPVQE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A25149
