ABflo[R] 488 Rabbit anti-Mouse IL-13 monoclonal antibody
Product Sizes
10 tests
£ POA
A25118-10TESTS
100 tests
£324.00
A25118-100TESTS
200 tests
£509.00
A25118-200TESTS
500 tests
£782.00
A25118-500TESTS
About this Product
- SKU:
- A25118
- Additional Names:
- Il-13
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 488
- Extra Details:
- Predicted to enable interleukin-13 receptor binding activity. Involved in positive regulation of cold-induced thermogenesis and positive regulation of macrophage activation. Acts upstream of or within cellular response to cytokine stimulus; inflammatory response; and positive regulation of immune effector process. Located in cytoplasm; external side of plasma membrane; and extracellular space. Is expressed in gut; liver; male reproductive gland or organ; and thymus. Used to study atopic dermatitis. Human ortholog(s) of this gene implicated in several diseases, including allergic disease (multiple); autoimmune disease (multiple); diffuse scleroderma; lung disease (multiple); and nose disease (multiple). Orthologous to human IL13 (interleukin 13).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 14kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- PGPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A25118
