PADI4 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A25102-20UL
100 ul
£336.00
A25102-100UL
500 ul
£1258.00
A25102-500UL
1000 ul
£2228.00
A25102-1000UL
About this Product
- SKU:
- A25102
- Additional Names:
- PAD|PAD4|PADI4|PADI5|PDI4|PDI5
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This gene is a member of a gene family which encodes enzymes responsible for the conversion of arginine residues to citrulline residues. This gene may play a role in granulocyte and macrophage development leading to inflammation and immune response.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 67kda
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Sequence:
- DEMEIGYIQAPHKTLPVVFDSPRNRGLKEFPIKRVMGPDFGYVTRGPQTGGISGLDSFGNLEVSPPVTVRGKEYPLGRILFGDSCYPSNDSRQMHQALQDF
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A25102
