CBX7 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A25023-20UL
100 ul
£336.00
A25023-100UL
500 ul
£1258.00
A25023-500UL
1000 ul
£2228.00
A25023-1000UL
About this Product
- SKU:
- A25023
- Additional Names:
- CBX7
- Application:
- Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This gene encodes a protein that contains the CHROMO (CHRomatin Organization MOdifier) domain. The encoded protein is a component of the Polycomb repressive complex 1 (PRC1), and is thought to control the lifespan of several normal human cells.
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 35kda
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- NLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A25023
