CXCL1 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A25014-5UL
20 ul
£164.00
A25014-20UL
100 ul
£342.00
A25014-100UL
500 ul
£1532.00
A25014-500UL
1000 ul
£2704.00
A25014-1000UL
About this Product
- SKU:
- A25014
- Additional Names:
- CXCL1|Fsp|gro|Gro1|KC|Mgsa|N51|Scyb1
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- This gene encodes a protein that is a member of the CXC subfamily of chemokines. Chemokines, which recruit and activate leukocytes, are classified by function (inflammatory or homeostatic) or by structure. This secretory protein is proposed to bind the G-protein coupled receptor chemokine (C-X-C motif) receptor 2 to recruit neutrophils. In mouse, deficiency of this gene is associated with colitis and with defects in immune cell recruitment to the lung.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 45kDa (Recombinant Protein)
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A25014
