CD150/SLAM Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A24977-5UL
20 ul
£164.00
A24977-20UL
100 ul
£342.00
A24977-100UL
500 ul
£1532.00
A24977-500UL
1000 ul
£2704.00
A24977-1000UL
About this Product
- SKU:
- A24977
- Additional Names:
- 4933415F16|CD150|CD150/SLAM|CDw150|ESTM51|IPO-3|Slam
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Extra Details:
- Enables identical protein binding activity and signaling receptor activity. Involved in natural killer cell activation; positive regulation of activated T cell proliferation; and regulation of cytokine production. Acts upstream of or within several processes, including leukocyte chemotaxis involved in inflammatory response; positive regulation of leukocyte chemotaxis; and regulation of vesicle fusion. Located in external side of plasma membrane and phagocytic vesicle. Is expressed in liver lobe. Orthologous to human SLAMF1 (signaling lymphocytic activation molecule family member 1).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 38kda
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- TGGGVMDCPVILQKLGQDTWLPLTNEHQINKSVNKSVRILVTMATSPGSKSNKKIVSFDLSKGSYPDHLEDGYHFQSKNLSLKILGNRRESEGWYLVSVEENVSVQQFCKQLKLYEQVSPPEIKVLNKTQENENGTCSLLLACTVKKGDHVTYSWSDEAGTHLLSRANRSHLLHITLSNQHQDSIYNCTASNPVSSISRTFNLSSQACKQESSSESSP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A24977
