B Beta-Amyloid(1-40) Rabbit monoclonal antibody
Product Sizes
20 ul
£164.00
A24949-20UL
100 ul
£342.00
A24949-100UL
About this Product
- SKU:
- A24949
- Additional Names:
- AAA|ABETA|ABPP|AD1|alpha-sAPP|APPI|CTFgamma|CVAP|PN-II|PN2|preA4|B Beta-Amyloid(1-40)
- Application:
- Dot Blot, ELISA, IHC-Paraffin, Immunofluorescence
- Clonality:
- Monoclonal
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 4kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A24949
