B Beta-Amyloid(1-40) Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A24949-5UL
20 ul
£164.00
A24949-20UL
100 ul
£342.00
A24949-100UL
500 ul
£1532.00
A24949-500UL
1000 ul
£2704.00
A24949-1000UL
About this Product
- SKU:
- A24949
- Additional Names:
- AAA|ABETA|ABPP|AD1|alpha-sAPP|APPI|CTFgamma|CVAP|PN-II|PN2|preA4|B Beta-Amyloid(1-40)
- Application:
- Dot Blot, ELISA, IHC-Paraffin, Immunofluorescence
- Clonality:
- Monoclonal
- Extra Details:
- This gene encodes a cell surface receptor and transmembrane precursor protein that is cleaved by secretases to form a number of peptides. Some of these peptides are secreted and can bind to the acetyltransferase complex APBB1/TIP60 to promote transcriptional activation, while others form the protein basis of the amyloid plaques found in the brains of patients with Alzheimer disease. In addition, two of the peptides are antimicrobial peptides, having been shown to have bacteriocidal and antifungal activities. Mutations in this gene have been implicated in autosomal dominant Alzheimer disease and cerebroarterial amyloidosis (cerebral amyloid angiopathy). Multiple transcript variants encoding several different isoforms have been found for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 4kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A24949
