ABflo[R] 594 Rabbit anti-Mouse NK1.1/CD161c monoclonal antibody
Product Sizes
10 tests
£ POA
A24923-10TESTS
100 tests
£259.00
A24923-100TESTS
200 tests
£390.00
A24923-200TESTS
500 tests
£592.00
A24923-500TESTS
About this Product
- SKU:
- A24923
- Additional Names:
- CD161|Klrb1b|ly-55c|Ly-59|Ly55c|Ly59|Nk-1|Nk-1.2|NK-RP1|Nk1|NK1.1|Nk1.2|NKR-P1.9|NKRP1|NKRP140|Nkrp1b|Nkrp1c
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 647
- Extra Details:
- Enables identical protein binding activity and signaling receptor activity. Acts upstream of or within natural killer cell activation and positive regulation of natural killer cell mediated cytotoxicity. Located in external side of plasma membrane. Is integral component of plasma membrane. Is expressed in thymus primordium. Orthologous to human KLRB1 (killer cell lectin like receptor B1).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- Refer to figures
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- QKPSREKCCVFIQENLNKTTDCSVNLECPQDWLLHRDKCFHVSQVSNTWEEGQADCGRKGATLLLIQDQEELRFLLDSIKEKYNSFWIGLRFTLPDMNWKWINGTTFNSDVLKITGVTENGSCASILGDKVTPESCASDNRWICQKELNHETPSNDS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A24923
