ABflo[R] 594 Rabbit anti-Mouse CD267/TACI monoclonal antibody
Product Sizes
10 tests
£ POA
A24920-10TESTS
100 tests
£324.00
A24920-100TESTS
200 tests
£509.00
A24920-200TESTS
500 tests
£782.00
A24920-500TESTS
About this Product
- SKU:
- A24920
- Additional Names:
- 1200009E08Rik|Taci
- Application:
- Flow Cytometry
- Clonality:
- Monoclonal
- Conjugate:
- ABflo® 647
- Extra Details:
- Acts upstream of or within B cell homeostasis; hematopoietic progenitor cell differentiation; and negative regulation of B cell proliferation. Located in external side of plasma membrane. Is integral component of plasma membrane. Is expressed in renal vasculature. Used to study systemic lupus erythematosus. Human ortholog(s) of this gene implicated in common variable immunodeficiency. Orthologous to human TNFRSF13B (TNF receptor superfamily member 13B).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 27kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- FCPKDQYWDSSRKSCVSCALTCSQRSQRTCTDFCKFINCRKEQGRYYDHLLGACVSCDSTCTQHPQQCAHFCEKRPRSQANLQPELGRPQAGEVEVRSDNSGRHQGSEHGPGLRLSSDQLTLYCT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A24920
