DcR1/CD263 Rabbit monoclonal antibody
Product Sizes
20 ul
£164.00
A24912-20UL
100 ul
£342.00
A24912-100UL
About this Product
- SKU:
- A24912
- Additional Names:
- CD263|DCR1|DCR1-TNFR|DcR1/CD263|LIT|TNF receptor superfamily member 10c|TNFRSF10C|TRAIL-R3|TRAILR3|TRID
- Application:
- ELISA, Flow Cytometry, IHC-Paraffin, Western Blot
- Clonality:
- Monoclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 27kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAPAAEETMITSPGTP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A24912
