LHCGR Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A24884-20UL
100 ul
£336.00
A24884-100UL
500 ul
£1258.00
A24884-500UL
1000 ul
£2228.00
A24884-1000UL
About this Product
- SKU:
- A24884
- Additional Names:
- HHG|LCGR|LGR2|LH/CG-R|LH/CGR|LHCGR|LHR|LHRHR|LSH-R|lutropin-choriogonadotropic hormone receptor|ULG5
- Application:
- ELISA, Immunofluorescence, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This gene encodes the receptor for both luteinizing hormone and choriogonadotropin. This receptor belongs to the G-protein coupled receptor 1 family, and its activity is mediated by G proteins which activate adenylate cyclase. Mutations in this gene result in disorders of male secondary sexual character development, including familial male precocious puberty, also known as testotoxicosis, hypogonadotropic hypogonadism, Leydig cell adenoma with precocious puberty, and male pseudohermaphtoditism with Leydig cell hypoplasia.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 94kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- TSLELKENVHLEKMHNGAFRGATGPKTLDISSTKLQALPSYGLESIQRLIATSSYSLKKLPSRETFVNLLEATLTYPSHCCAFRNLPTKEQNFSHSISENF
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A24884
